Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 2
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
$25.00
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
$25.00
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
$25.00
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
Grand Theft Auto 5 decal skin for PS5 Disc Edition Console..
$25.00
Graffiti decal skin for PS5 Disc Edition Console and two C..
Graffiti decal skin for PS5 Disc Edition Console and two C..
$25.00
Graffiti decal skin for PS5 Disc Edition Console and two C..
Graffiti decal skin for PS5 Disc Edition Console and two C..
$25.00
Graffiti decal skin for PS5 Disc Edition Console and two C..
Graffiti decal skin for PS5 Disc Edition Console and two C..
$25.00
Graffiti decal skin for PS5 Disc Edition Console and two C..
Graffiti decal skin for PS5 Disc Edition Console and two C..
$25.00
Graffiti decal skin for PS5 Disc Edition Console and two C..
Graffiti decal skin for PS5 Disc Edition Console and two C..
$25.00
Graffiti Butterfly decal skin for PS5 Disc Edition Console..
Graffiti Butterfly decal skin for PS5 Disc Edition Console..
$25.00
Gradient colors decal skin for PS5 Disc Edition Console an..
Gradient colors decal skin for PS5 Disc Edition Console an..
$25.00
Gradient colors decal skin for PS5 Disc Edition Console an..
Gradient colors decal skin for PS5 Disc Edition Console an..
$25.00
Gradient colors decal skin for PS5 Disc Edition Console an..
Gradient colors decal skin for PS5 Disc Edition Console an..
$25.00
Gradient colors decal skin for PS5 Disc Edition Console an..
Gradient colors decal skin for PS5 Disc Edition Console an..
$25.00
Gradient colors decal skin for PS5 Disc Edition Console an..
Gradient colors decal skin for PS5 Disc Edition Console an..
$25.00
Gradient color decal skin for PS5 Disc Edition Console and..
Gradient color decal skin for PS5 Disc Edition Console and..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War decal skin for PS5 Disc Edition Console and two..
God of War decal skin for PS5 Disc Edition Console and two..
$25.00
God of War 4 decal skin for PS5 Disc Edition Console and t..
God of War 4 decal skin for PS5 Disc Edition Console and t..
$25.00
God of War 4 decal skin for PS5 Disc Edition Console and t..
God of War 4 decal skin for PS5 Disc Edition Console and t..
$25.00
God of War 4 decal skin for PS5 Disc Edition Console and t..
God of War 4 decal skin for PS5 Disc Edition Console and t..
$25.00
God of War 4 decal skin for PS5 Disc Edition Console and t..
God of War 4 decal skin for PS5 Disc Edition Console and t..
$25.00
God of War 4 decal skin for PS5 Disc Edition Console and t..
God of War 4 decal skin for PS5 Disc Edition Console and t..
$25.00
Glossy Texture decal skin for PS5 Disc Edition Console and..
Glossy Texture decal skin for PS5 Disc Edition Console and..
$25.00
Glass Texture decal skin for PS5 Disc Edition Console and ..
Glass Texture decal skin for PS5 Disc Edition Console and ..
$25.00
Glasgow Rangers FC decal skin for PS5 Disc Edition Console..
Glasgow Rangers FC decal skin for PS5 Disc Edition Console..
$25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i