Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 3
The Joker decal skin for PS5 Disc Edition Console and two ..
The Joker decal skin for PS5 Disc Edition Console and two ..
$25.00
The Joker decal skin for PS5 Disc Edition Console and two ..
The Joker decal skin for PS5 Disc Edition Console and two ..
$25.00
The Joker decal skin for PS5 Disc Edition Console and two ..
The Joker decal skin for PS5 Disc Edition Console and two ..
$25.00
The Joker decal skin for PS5 Disc Edition Console and two ..
The Joker decal skin for PS5 Disc Edition Console and two ..
$25.00
The Avengers decal skin for PS5 Disc Edition Console and t..
The Avengers decal skin for PS5 Disc Edition Console and t..
$25.00
Tampa Bay Rays decal skin for PS5 Disc Edition Console and..
Tampa Bay Rays decal skin for PS5 Disc Edition Console and..
$25.00
Super Mario decal skin for PS5 Disc Edition Console and tw..
Super Mario decal skin for PS5 Disc Edition Console and tw..
$25.00
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
$25.00
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
$25.00
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
Street Fighter 6 decal skin for PS5 Disc Edition Console a..
$25.00
Stranger Things decal skin for PS5 Disc Edition Console an..
Stranger Things decal skin for PS5 Disc Edition Console an..
$25.00
Stranger Things decal skin for PS5 Disc Edition Console an..
Stranger Things decal skin for PS5 Disc Edition Console an..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry Sky decal skin for PS5 Disc Edition Console and two..
Starry Sky decal skin for PS5 Disc Edition Console and two..
$25.00
Star Wars Fallen Order decal skin for PS5 Disc Edition Con..
Star Wars Fallen Order decal skin for PS5 Disc Edition Con..
$25.00
Star Wars decal skin for PS5 Disc Edition Console and two ..
Star Wars decal skin for PS5 Disc Edition Console and two ..
$25.00
Star Wars Darth Vader decal skin for PS5 Disc Edition Cons..
Star Wars Darth Vader decal skin for PS5 Disc Edition Cons..
$25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i