Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
PS5 Disc Skin's Store 4
Monster Hunter World decal skin for PS5 Disc Edition Conso..
Monster Hunter World decal skin for PS5 Disc Edition Conso..
$25.00
Monster Hunter World decal skin for PS5 Disc Edition Conso..
Monster Hunter World decal skin for PS5 Disc Edition Conso..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Spider Man decal skin for PS5 Disc Edition Console and two..
Spider Man decal skin for PS5 Disc Edition Console and two..
$25.00
Final Fantasy 7 decal skin for PS5 Disc Edition Console an..
Final Fantasy 7 decal skin for PS5 Disc Edition Console an..
$25.00
Final Fantasy 7 decal skin for PS5 Disc Edition Console an..
Final Fantasy 7 decal skin for PS5 Disc Edition Console an..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
The Witcher Wild Hunt decal skin for PS5 Disc Edition Cons..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
Starry sky decal skin for PS5 Disc Edition Console and two..
Starry sky decal skin for PS5 Disc Edition Console and two..
$25.00
Golden State Warriors decal skin for PS5 Disc Edition Cons..
Golden State Warriors decal skin for PS5 Disc Edition Cons..
$25.00
Wisconsin Badgers decal skin for PS5 Disc Edition Console ..
Wisconsin Badgers decal skin for PS5 Disc Edition Console ..
$25.00
Inter Milan decal skin for PS5 Disc Edition Console and tw..
Inter Milan decal skin for PS5 Disc Edition Console and tw..
$25.00
Juventus FT decal skin for PS5 Disc Edition Console and tw..
Juventus FT decal skin for PS5 Disc Edition Console and tw..
$25.00
Juventus FT decal skin for PS5 Disc Edition Console and tw..
Juventus FT decal skin for PS5 Disc Edition Console and tw..
$25.00
Red Dead Redemption 2 decal skin for PS5 Disc Edition Cons..
Red Dead Redemption 2 decal skin for PS5 Disc Edition Cons..
$25.00
AC Milan decal skin for PS5 Disc Edition Console and two C..
AC Milan decal skin for PS5 Disc Edition Console and two C..
$25.00
Geometric shapes decal skin for PS5 Disc Edition Console a..
Geometric shapes decal skin for PS5 Disc Edition Console a..
$25.00
Overwatch decal skin for PS5 Disc Edition Console and two ..
Overwatch decal skin for PS5 Disc Edition Console and two ..
$25.00
Atletico madrid decal skin for PS5 Disc Edition Console an..
Atletico madrid decal skin for PS5 Disc Edition Console an..
$25.00
Overwatch decal skin for PS5 Disc Edition Console and two ..
Overwatch decal skin for PS5 Disc Edition Console and two ..
$25.00
Atletico madrid decal skin for PS5 Disc Edition Console an..
Atletico madrid decal skin for PS5 Disc Edition Console an..
$25.00
Overwatch decal skin for PS5 Disc Edition Console and two ..
Overwatch decal skin for PS5 Disc Edition Console and two ..
$25.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i