Product Added to your Cart
x

-------- OR --------

USD
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGBPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
Croatia Croatia France France Hebrew Hebrew Hungary Hungary Vietnamese Vietnamese Greece Greece Czech Republic Czech Republic Denmark Denmark Romania Romania Finland Finland
$0.00
Xbox1 Skins Store 5
Pink carbon fiber decal skin for Xbox one Console and 2 Co..
Pink carbon fiber decal skin for Xbox one Console and 2 Co..
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Overwatch decal skin for Xbox one Console and 2 Controllers
Overwatch decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nioh 2 decal skin for Xbox one Console and 2 Controllers
Nioh 2 decal skin for Xbox one Console and 2 Controllers
$22.00
Nike decal skin for Xbox one Console and 2 Controllers
Nike decal skin for Xbox one Console and 2 Controllers
$22.00
Nike decal skin for Xbox one Console and 2 Controllers
Nike decal skin for Xbox one Console and 2 Controllers
$22.00
Nike decal skin for Xbox one Console and 2 Controllers
Nike decal skin for Xbox one Console and 2 Controllers
$22.00
Nike decal skin for Xbox one Console and 2 Controllers
Nike decal skin for Xbox one Console and 2 Controllers
$22.00
New York Mets decal skin for Xbox one Console and 2 Contro..
New York Mets decal skin for Xbox one Console and 2 Contro..
$22.00
New York Knicks decal skin for Xbox one Console and 2 Cont..
New York Knicks decal skin for Xbox one Console and 2 Cont..
$22.00
Neutral decal skin for Xbox one Console and 2 Controllers
Neutral decal skin for Xbox one Console and 2 Controllers
$22.00
Neal decal skin for Xbox one Console and 2 Controllers
Neal decal skin for Xbox one Console and 2 Controllers
$22.00
Neal decal skin for Xbox one Console and 2 Controllers
Neal decal skin for Xbox one Console and 2 Controllers
$22.00
Create a free online store
Powered by freewebstore
Get your free online store today - Be your own boss!
freewebstore
Got a great business idea?
Get a free online store just like this one!
What do I get?
Full eCommerce store
Free hosting
Unlimited products
Domain & Free SSL
checkout
24/7 support
And more...
Why freewebstore?
20+ years
1M+ stores created
No payment required
Easy to create
What's the catch?
Nope, no catch
0% commission
Free forever!
Premium upgrades available
Get Started
i